PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03700.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 348aa    MW: 38903.5 Da    PI: 5.4081
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03700.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-151562148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+W +eEd++l  ++++ G g+W++ ++  g++R++k+c++rw +yl
  Rsa1.0_03700.1_g00005.1 15 KGPWVPEEDDKLTAYIEKNGYGNWRSLPKLAGLNRCGKSCRLRWMNYL 62
                             79********************************************97 PP

2Myb_DNA-binding55.81.1e-1768113148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg ++ eE+  +v+++++lG++ W++Ia++++ gRt++++k++w++++
  Rsa1.0_03700.1_g00005.1  68 RGEFSDEEESTIVRLHALLGNK-WSKIASHLP-GRTDNEIKNYWNTHM 113
                              899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.9131062IPR017930Myb domain
SuperFamilySSF466895.99E-3012109IPR009057Homeodomain-like
SMARTSM007174.0E-121464IPR001005SANT/Myb domain
PfamPF002493.7E-141562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-231669IPR009057Homeodomain-like
CDDcd001677.10E-101762No hitNo description
PROSITE profilePS5129426.53463117IPR017930Myb domain
SMARTSM007171.0E-1667115IPR001005SANT/Myb domain
PfamPF002495.3E-1668112IPR001005SANT/Myb domain
CDDcd001671.55E-1270113No hitNo description
Gene3DG3DSA:1.10.10.605.1E-2770117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGRSPCCDQD KGVKKGPWVP EEDDKLTAYI EKNGYGNWRS LPKLAGLNRC GKSCRLRWMN  60
YLRPDIRRGE FSDEEESTIV RLHALLGNKW SKIASHLPGR TDNEIKNYWN THMRKKMLQM  120
GIDPITHEPR TNDLSPILDV SQMLAAAIST GQLGNSNFLN NNNTSLEDLL KLQLIHKMLL  180
IITPKAIPNS FTTNSLDPKP EAVVNSYNTN SVNPKPEQAA GHLNANEQHV IINQSENEDF  240
MQSFEHIWDG YENNQLPGLV TVSQKNLNSA KPGIITGYHG DQLSEIPSNG SLSVSPETSS  300
LNYPGTTQPS TGPDVLEDWE KFLDDETSDS CWKSFLDLTS PTSSPGPW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-261511727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00438DAPTransfer from AT4G17785Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1834920.0AC183492.1 Brassica oleracea Contig G, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013589894.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP00.0MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A078IU410.0A0A078IU41_BRANA; BnaAnng13560D protein
STRINGBra040181.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122431730
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17785.10.0myb domain protein 39